Structure of PDB 8ckb Chain P002 Binding Site BS02

Receptor Information
>8ckb Chain P002 (length=107) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKMLEISEEAITRYFTTLSQFGYKKYSDVDKIIVLFFMEEMLAGEMSYY
VTQDDYRNIVNALYCLAGSTCMIDFPMFESYDTLVHSNNRTFVPRITEDS
ILRSTED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ckb Structural atlas of the most abundant human gut virus
Resolution4.39 Å
Binding residue
(original residue number in PDB)
S48 Y49
Binding residue
(residue number reindexed from 1)
S48 Y49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum8ckb
PubMed
UniProtA0A385DTH1|THA_BPCA1 Tail hub protein A (Gene Name=crAss001_38)

[Back to BioLiP]