Structure of PDB 8war Chain P Binding Site BS02

Receptor Information
>8war Chain P (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK
Ligand information
>8war Chain Y (length=73) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtccgtaggcacgtctgctcggctcgaagtagatccagttgatgcacaac
cacccccttttataggcgccctt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8war Structural Visualization of de novo Transcription Initiation.
Resolution7.2 Å
Binding residue
(original residue number in PDB)		Q166 N167 R196 F197 R203 T210 L212 T222 V259 F288 P289 F305 S307 K309
Binding residue
(residue number reindexed from 1)		Q8 N9 R38 F39 R45 T52 L54 T64 V101 F130 P131 F147 S149 K151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001046 core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001093 TFIIB-class transcription factor binding
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017162 aryl hydrocarbon receptor binding
GO:0019899 enzyme binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006383 transcription by RNA polymerase III
GO:0007283 spermatogenesis
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045893 positive regulation of DNA-templated transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0000785 chromatin
GO:0000791 euchromatin
GO:0001673 male germ cell nucleus
GO:0001674 female germ cell nucleus
GO:0001939 female pronucleus
GO:0001940 male pronucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005668 RNA polymerase transcription factor SL1 complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0045120 pronucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8war, PDBe:8war, PDBj:8war
PDBsum8war
PubMed38127763
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]