Structure of PDB 8qu1 Chain P Binding Site BS02

Receptor Information

>8qu1 Chain P (length=141) Species: 9606 (Homo sapiens)

VENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQH
HVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLE
AGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIY

Ligand information

>8qu1 Chain B (length=56)

agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga

<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8qu1 GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Resolution: 2.74 Å
• Binding residue (original residue number in PDB): T86 Q87 H88 H89 R120 N121 V122 D156 S157
• Binding residue (residue number reindexed from 1): T48 Q49 H50 H51 R82 N83 V84 D118 S119

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0008097 5S rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation
• GO:0035928 rRNA import into mitochondrion

Cellular Component

• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qu1, PDBe:8qu1, PDBj:8qu1
• PDBsum: 8qu1
• PubMed: 38969660
• UniProt: Q9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)