Structure of PDB 8k5o Chain P Binding Site BS02

Receptor Information
>8k5o Chain P (length=63) Species: 1052 (Halorhodospira halochloris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MWKLWKFVDFRMTAVGFHLFFALLAFAVHFACISSERFNWLEGAPAAEYY
MDEDPGIWKRTSY
Ligand information
>8k5o Chain 2 (length=29) Species: 1052 (Halorhodospira halochloris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TGEAVWLIWFMAALALIGGALPIVVKWWR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		D9 M12 G16 L19 F20 L23 F26 A27 F30 A31 S34
Binding residue
(residue number reindexed from 1)		D9 M12 G16 L19 F20 L23 F26 A27 F30 A31 S34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0046872 metal ion binding
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8k5o, PDBe:8k5o, PDBj:8k5o
PDBsum8k5o
PubMed38411333
UniProtA0A0X8XBE4

[Back to BioLiP]