Structure of PDB 8ev3 Chain P Binding Site BS02

Receptor Information

>8ev3 Chain P (length=148) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNV
KEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEAN
AEAKGLDMDKLIIKHVQVNAAPKQAYLSSPSHIEIIVAEEEEAVPKAN

Ligand information

>8ev3 Chain 2 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacugcgccuuuggguucuaccaaaggcaugccuguuugagugucauu

..........................................<<<<<<<<
.....>>>>.....<.<<<.......>........>>>..>...>>>...
.<<...>><<<<<<<<......>>>>>>>>....................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R3 S5 R61 N120 A121 P123 H145
Binding residue (residue number reindexed from 1)	R2 S4 R60 N119 A120 P122 H132

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
PDBsum	8ev3
PubMed	36423630
UniProt	O14339\|RL17A_SCHPO Large ribosomal subunit protein uL22A (Gene Name=rpl1701)

[Back to BioLiP]