Structure of PDB 8a5i Chain P Binding Site BS02

Receptor Information
>8a5i Chain P (length=133) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNRQIEAAR
IAMTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGK
IMFEIAGVPEDVAREALRLAAHKLPVKTKIVKR
Ligand information
>8a5i Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccauaccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a5i Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N16 M17 R18 G19 R99
Binding residue
(residue number reindexed from 1)		N15 M16 R17 G18 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a5i, PDBe:8a5i, PDBj:8a5i
PDBsum8a5i
PubMed36300626
UniProtQ927L4|RL16_LISMO Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]