Structure of PDB 7w5a Chain P Binding Site BS02

Receptor Information

>7w5a Chain P (length=113) Species: 9606 (Homo sapiens)

TTAARPTFEPARGGRGKQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNR
DFRRELEERERAAAREKNRDRWDDDVVFKNCAKGVDDQKKDKRFVNDTLR
SEFHKKFMEKYIK

Ligand information

>7w5a Chain F (length=97)

gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu

<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7w5a Mechanism of exon ligation by human spliceosome.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): T2 T3 A5 R6 T8 A12 R33
• Binding residue (residue number reindexed from 1): T1 T2 A4 R5 T7 A11 R26

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005739 mitochondrion
• GO:0016607 nuclear speck
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7w5a, PDBe:7w5a, PDBj:7w5a
• PDBsum: 7w5a
• PubMed: 35705093
• UniProt: Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)