Structure of PDB 7u4d Chain P Binding Site BS02

Receptor Information
>7u4d Chain P (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLAL
QEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGL
Ligand information
>7u4d Chain U (length=139) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatgtatatatctgacacgtgcctggagactagggagtaatccccttggc
ggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagc
tgtctacgaccaattgagcggcctcggcaccggattctc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u4d CENP-N promotes the compaction of centromeric chromatin.
Resolution8.1 Å
Binding residue
(original residue number in PDB)		R63 R72 N85 Q87 R118 V119
Binding residue
(residue number reindexed from 1)		R19 R28 N41 Q43 R74 V75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0000281 mitotic cytokinesis
GO:0034080 CENP-A containing chromatin assembly
GO:0051301 cell division
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
GO:0071459 protein localization to chromosome, centromeric region
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005829 cytosol
GO:0043505 CENP-A containing nucleosome
GO:0061638 CENP-A containing chromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u4d, PDBe:7u4d, PDBj:7u4d
PDBsum7u4d
PubMed35422519
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]