Structure of PDB 7oi8 Chain P Binding Site BS02

Receptor Information
>7oi8 Chain P (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQH
HVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLE
AGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIY
Ligand information
>7oi8 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oi8 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T86 Q87 H88 H89 K113 Y117 S118 R120 N121 V122 W151 S157
Binding residue
(residue number reindexed from 1)		T48 Q49 H50 H51 K75 Y79 S80 R82 N83 V84 W113 S119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0035928 rRNA import into mitochondrion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi8, PDBe:7oi8, PDBj:7oi8
PDBsum7oi8
PubMed34315873
UniProtQ9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)

[Back to BioLiP]