Structure of PDB 7ods Chain P Binding Site BS02

Receptor Information
>7ods Chain P (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRT
QHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRC
LEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
Ligand information
>7ods Chain B (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaguguagcuuaacacaaagcacccaacuuacacuuaggagauuucaa
cuuaacuugaccgcucugacca
<<<<<<...<<<........>>>.<<.<<.......>>.>>.....<<<<
......>>>>..>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ods Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T86 Q87 H88 H89 R108 W110 K113 R120 V122 S155 S157
Binding residue
(residue number reindexed from 1)		T50 Q51 H52 H53 R72 W74 K77 R84 V86 S119 S121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0035928 rRNA import into mitochondrion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ods, PDBe:7ods, PDBj:7ods
PDBsum7ods
PubMed34135320
UniProtQ9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)

[Back to BioLiP]