Structure of PDB 7o9k Chain P Binding Site BS02

Receptor Information
>7o9k Chain P (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQH
HVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLE
AGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIY
Ligand information
>7o9k Chain B (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaacacaaagcacccaacuuacacuuaggagauucaauu
gacgcucuga
<<<<<...<<<........>>>.<<.<<.......>>.>>....<<<..>
>>.>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o9k Structural basis for late maturation steps of the human mitoribosomal large subunit.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R85 T86 Q87 H88 H89 E109 W110 K113 V122 W151 D156
Binding residue
(residue number reindexed from 1)		R47 T48 Q49 H50 H51 E71 W72 K75 V84 W113 D118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o9k, PDBe:7o9k, PDBj:7o9k
PDBsum7o9k
PubMed34135318
UniProtA8K9D2

[Back to BioLiP]