Structure of PDB 7nhn Chain P Binding Site BS02

Receptor Information
>7nhn Chain P (length=133) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNRQIEAAR
IAMTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGK
IMFEIAGVPEDVAREALRLAAHKLPVKTKIVKR
Ligand information
>7nhn Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccaucccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		N16 M17 R18 G19
Binding residue
(residue number reindexed from 1)		N15 M16 R17 G18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
PDBsum7nhn
PubMed34117249
UniProtQ927L4|RL16_LISMO Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]