Structure of PDB 7l08 Chain P Binding Site BS02

Receptor Information
>7l08 Chain P (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQ
HHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCL
EAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
Ligand information
>7l08 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<<>>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l08 Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
Resolution3.49 Å
Binding residue
(original residue number in PDB)		T86 Q87 H88 H89 N121 V122 W151 S155 S157
Binding residue
(residue number reindexed from 1)		T49 Q50 H51 H52 N84 V85 W114 S118 S120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7l08, PDBe:7l08, PDBj:7l08
PDBsum7l08
PubMed34127662
UniProtA8K9D2

[Back to BioLiP]