Structure of PDB 6zym Chain P Binding Site BS02

Receptor Information
>6zym Chain P (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMR
FKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNK
EYYTQNMEREISNSDGTRPTSDMLLKLARTTPYYKRNRPHICSFWVKGEC
KRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRAS
Ligand information
>6zym Chain Y (length=41) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaaaugaugucauacuuauccug
.........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zym Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K46 R64 K66 E69 C84 G91 L92 R152 Y156 R159 H163 T187 L193 A194 Q196 I198 R201 R216
Binding residue
(residue number reindexed from 1)		K32 R50 K52 E55 C70 G77 L78 R129 Y133 R136 H140 T164 L170 A171 Q173 I175 R178 R193
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6zym, PDBe:6zym, PDBj:6zym
PDBsum6zym
PubMed33007253
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]