Structure of PDB 6ri5 Chain P Binding Site BS02

Receptor Information
>6ri5 Chain P (length=269) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTN
KDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIAR
RTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGA
RVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQY
MEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTE
KKFTKEQYAAESKKYRQTK
Ligand information
>6ri5 Chain x (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<....<<<.<<..............>>...
.>>...>>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ri5 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I69 G71 D72 V74 H90 G91 T93 N94 Q151 T155 G156 A157 R158 Y198 H203 Y207 R218 E221 L222 F253 T256 K258 F260 K262 Q264 Y265 A266 E268 S269 Y272 Q274 K276
Binding residue
(residue number reindexed from 1)		S6 S7 F9 T11 F13 R14 R15 R17 K20 T21 Y23 R26 R43 R47 T49 N50 K51 Q56 I62 G64 D65 V67 H83 G84 T86 N87 Q144 T148 G149 A150 R151 Y191 H196 Y200 R211 E214 L215 F246 T249 K251 F253 K255 Q257 Y258 A259 E261 S262 Y265 Q267 K269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ri5, PDBe:6ri5, PDBj:6ri5
PDBsum6ri5
PubMed31115337
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]