Structure of PDB 6qdv Chain P Binding Site BS02

Receptor Information
>6qdv Chain P (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAP
EEVRNRDFRRELEERERAAAREKNRWDDDVVFKNCRFVNDTLRSEFHKKF
MEKYIK
Ligand information
>6qdv Chain 5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccgu
ggagaggaacaaccaauuuuuugag
<<<<<<<<<<<........<<<<<<<<...........>>>>>>>>...>
>>>>>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S32 R33 P36 S37 H38 T39
Binding residue
(residue number reindexed from 1)		S31 R32 P35 S36 H37 T38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005739 mitochondrion
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtQ9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)

[Back to BioLiP]