Structure of PDB 6bok Chain P Binding Site BS02

Receptor Information
>6bok Chain P (length=110) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF
Ligand information
>6bok Chain C (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga
<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bok Conformational Control of Translation Termination on the 70S Ribosome.
Resolution3.55 Å
Binding residue
(original residue number in PDB)
K11 R15 K19 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 V46 T47 S50 L54 N61 K62 T63 Y92 K93 H95 R97
Binding residue
(residue number reindexed from 1)
K9 R13 K17 R23 F27 R28 S29 L30 K31 H32 Y34 Q36 V44 T45 S48 L52 N59 K60 T61 Y90 K91 H93 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum6bok
PubMed29731232
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]