Structure of PDB 6bok Chain P Binding Site BS02

Receptor Information

>6bok Chain P (length=110) Species: 262724 (Thermus thermophilus HB27)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>6bok Chain C (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Resolution: 3.55 Å
• Binding residue (original residue number in PDB): K11 R15 K19 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 V46 T47 S50 L54 N61 K62 T63 Y92 K93 H95 R97
• Binding residue (residue number reindexed from 1): K9 R13 K17 R23 F27 R28 S29 L30 K31 H32 Y34 Q36 V44 T45 S48 L52 N59 K60 T61 Y90 K91 H93 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: Q72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)