Structure of PDB 5wsg Chain P Binding Site BS02

Receptor Information
>5wsg Chain P (length=201) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTDQIAKNVKLDDFIPKRQSNFELSVPLPTKAEIQECTARTKSYIQRLVN
AKLANSNNRASSRYVAPANLLLNNSHHIEVVSKQMDPLLPRFVGKKARKV
VAPTENDEVVPVLHMGEADPNEWKIPAAVSNWKNPNGYTVALERRVENNT
INDGFMKLSEALENADKKARQEIRSKMELKRLAMEQEMLAKESKLKELSQ
R
Ligand information
>5wsg Chain E (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua
<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wsg Structure of a yeast step II catalytically activated spliceosome
Resolution4.0 Å
Binding residue
(original residue number in PDB)
K117 V127 V135
Binding residue
(residue number reindexed from 1)
K83 V93 V101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wsg, PDBe:5wsg, PDBj:5wsg
PDBsum5wsg
PubMed27980089
UniProtP28004|PRP45_YEAST Pre-mRNA-processing protein 45 (Gene Name=PRP45)

[Back to BioLiP]