Structure of PDB 5mps Chain P Binding Site BS02

Receptor Information
>5mps Chain P (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKFSWRKGTAFGRY
INDMTKSEYHQEFLHKHVR
Ligand information
>5mps Chain 6 (length=99) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuuau
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mps Structure of a spliceosome remodelled for exon ligation.
Resolution3.85 Å
Binding residue
(original residue number in PDB)		S4 Q8 R12 H27 R29
Binding residue
(residue number reindexed from 1)		S1 Q5 R9 H24 R26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mps, PDBe:5mps, PDBj:5mps
PDBsum5mps
PubMed28076345
UniProtQ03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]