Structure of PDB 5lj3 Chain P Binding Site BS02

Receptor Information

>5lj3 Chain P (length=36) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKF

Ligand information

>5lj3 Chain Z (length=171) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuguaa
caacugaaaugaccuaggcucauuguuacaauacacauuuuuuggggacg
ggaagaggagacgucgcgacccucgcagagucguucuugacuuggucgcu
ugauguuucuucuucccguuc

.............................................<<<<<
<<<......<<<<<<>>>.>>>>>>>>>>>...............<<<<<
<<<<<<.<<<<<<<<<<<<.<<.....<<<<<<....>>>>>>>>>>>>.
.>>>>>>>>.>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lj3 Cryo-EM structure of the spliceosome immediately after branching.
Resolution	3.8 Å
Binding residue (original residue number in PDB)	L9 E10 A11
Binding residue (residue number reindexed from 1)	L3 E4 A5

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0045292	mRNA cis splicing, via spliceosome

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0071013	catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
PDBsum	5lj3
PubMed	27459055
UniProt	Q03772\|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]