Structure of PDB 3j9m Chain P Binding Site BS02

Receptor Information
>3j9m Chain P (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA
LVEHQNGKVVVSASTREWAIKKHNVVACESIGRVLAQRCLEAGINFMVYQ
PTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
Ligand information
>3j9m Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<<>>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j9m Ribosome. The structure of the human mitochondrial ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		T85 Q86 H87 H88 R107 W109 K112 N120 V121 W150 S154 D155 S156
Binding residue
(residue number reindexed from 1)		T44 Q45 H46 H47 R66 W68 K71 N74 V75 W104 S108 D109 S110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
PDBsum3j9m
PubMed25838379
UniProtA8K9D2

[Back to BioLiP]