Structure of PDB 1zq3 Chain P Binding Site BS02

Receptor Information

>1zq3 Chain P (length=68) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWF
KNRRRRHKIQSDQHKDQS

Ligand information

>1zq3 Chain B (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggggattagagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zq3 The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.
Resolution	N/A
Binding residue (original residue number in PDB)	R3 R4 T5 L27 K47 K51 R54 R55 K58
Binding residue (residue number reindexed from 1)	R3 R4 T5 L27 K47 K51 R54 R55 K58
Binding affinity	PDBbind-CN: Kd=428pM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1zq3, PDBe:1zq3, PDBj:1zq3
PDBsum	1zq3
PubMed	16406070
UniProt	P09081\|BCD_DROME Homeotic protein bicoid (Gene Name=bcd)

[Back to BioLiP]