Structure of PDB 1skn Chain P Binding Site BS02

Receptor Information
>1skn Chain P (length=74) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKI
RRRGKNKVAARTCRQRRTDRHDKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1skn A new DNA-binding motif in the Skn-1 binding domain-DNA complex.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R503 R506 K510 C518 R521
Binding residue
(residue number reindexed from 1)		R48 R51 K55 C63 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1skn, PDBe:1skn, PDBj:1skn
PDBsum1skn
PubMed9628487
UniProtP34707|SKN1_CAEEL Protein skinhead-1 (Gene Name=skn-1)

[Back to BioLiP]