Structure of PDB 1nk3 Chain P Binding Site BS02

Receptor Information

>1nk3 Chain P (length=63) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWF
QNHRYKTKRAQNE

Ligand information

>1nk3 Chain B (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acagccacttgacaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nk3 Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
Resolution	N/A
Binding residue (original residue number in PDB)	R102 K103 R104 R105 Q150 R153 Y154
Binding residue (residue number reindexed from 1)	R3 K4 R5 R6 Q51 R54 Y55

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nk3, PDBe:1nk3, PDBj:1nk3
PDBsum	1nk3
PubMed	9154919
UniProt	P22808\|VND_DROME Homeobox protein vnd (Gene Name=vnd)

[Back to BioLiP]