Structure of PDB 1nk2 Chain P Binding Site BS02

Receptor Information

>1nk2 Chain P (length=77) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTP
TQVKIWFQNHRYKTKRAQNEKGYEGHP

Ligand information

>1nk2 Chain B (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acagccacttgacaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nk2 Interactions of the vnd/NK-2 homeodomain with DNA by nuclear magnetic resonance spectroscopy: basis of binding specificity.
Resolution	N/A
Binding residue (original residue number in PDB)	R110 K111 R112 R113 Y162
Binding residue (residue number reindexed from 1)	R10 K11 R12 R13 Y62
Binding affinity	PDBbind-CN: Kd=0.19nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nk2, PDBe:1nk2, PDBj:1nk2
PDBsum	1nk2
PubMed	9154919
UniProt	P22808\|VND_DROME Homeobox protein vnd (Gene Name=vnd)

[Back to BioLiP]