Structure of PDB 1lfu Chain P Binding Site BS02

Receptor Information
>1lfu Chain P (length=82) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVS
NWFGNKRIRYKKNIGKFQEEANIYAAKTAVTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lfu Lock and Key Binding of the HOX YPWM Peptide to the PBX Homeodomain
ResolutionN/A
Binding residue
(original residue number in PDB)		M0 A1 R2 R3 K4 P24 Y25 R53 I54
Binding residue
(residue number reindexed from 1)		M1 A2 R3 R4 K5 P28 Y29 R57 I58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lfu, PDBe:1lfu, PDBj:1lfu
PDBsum1lfu
PubMed12409300
UniProtP41778|PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 (Gene Name=Pbx1)

[Back to BioLiP]