Structure of PDB 1ahd Chain P Binding Site BS02

Receptor Information
>1ahd Chain P (length=68) Species: 7241 (Drosophila subobscura) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWF
QNRRMKWKKENKTKGEPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ahd Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q6 Y8 R43 I47 Q50
Binding residue
(residue number reindexed from 1)		Q7 Y9 R44 I48 Q51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ahd, PDBe:1ahd, PDBj:1ahd
PDBsum1ahd
PubMed7903398
UniProtQ24645|ANTP_DROSU Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]