Structure of PDB 5juo Chain OA Binding Site BS02

Receptor Information
>5juo Chain OA (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA
Ligand information
>5juo Chain C (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<.<<<<((
....>>>>.......<<<......))..............>>>.......
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5juo Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		K14 N20 R21 C22 F27 V29 K32 Y39 A42 H57 T58 T59 T61 G62 R63 M64 R65 Y66 L67 R72 F74 N76 F78 Q79 G81 S82 A83
Binding residue
(residue number reindexed from 1)		K13 N19 R20 C21 F26 V28 K31 Y38 A41 H56 T57 T58 T60 G61 R62 M63 R64 Y65 L66 R71 F73 N75 F77 Q78 G80 S81 A82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5juo, PDBe:5juo, PDBj:5juo
PDBsum5juo
PubMed27159452
UniProtP49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)

[Back to BioLiP]