Structure of PDB 4u3m Chain O1 Binding Site BS02

Receptor Information

>4u3m Chain O1 (length=109) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED

Ligand information

InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6

OWCQTVJQFLTQTE-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 12.01 CACTVS 3.370 OpenEye OEToolkits 1.7.0	N[Os](N)(N)(N)(N)N

Formula

H12 N6 Os

Name

osmium (III) hexammine;
osmium(6+) hexaazanide

PDB chain

4u3m Chain O1 Residue 202 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4u3m ?
Resolution	3.0 Å
Binding residue (original residue number in PDB)	E82 E83
Binding residue (residue number reindexed from 1)	E79 E80
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006450	regulation of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u3m, PDBe:4u3m, PDBj:4u3m
PDBsum	4u3m
PubMed	25209664
UniProt	P0C2H8\|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]