Structure of PDB 8vk4 Chain O Binding Site BS02

Receptor Information

>8vk4 Chain O (length=93) Species: 10090 (Mus musculus)

GSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKD
ADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 8vk4 Chain O Residue 7002

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8vk4 Structural insights into the regulation of RyR1 by S100A1.
• Resolution: 3.56 Å
• Binding residue (original residue number in PDB): D63 N65 D67 E69 E74
• Binding residue (residue number reindexed from 1): D62 N64 D66 E68 E73
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0044548 S100 protein binding
• GO:0046872 metal ion binding
• GO:0051117 ATPase binding

Biological Process

• GO:0008016 regulation of heart contraction
• GO:0051000 positive regulation of nitric-oxide synthase activity
• GO:1903672 positive regulation of sprouting angiogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0016529 sarcoplasmic reticulum

External links

• PDB: RCSB:8vk4, PDBe:8vk4, PDBj:8vk4
• PDBsum: 8vk4
• PubMed: 38917010
• UniProt: Q91V77