Structure of PDB 8evi Chain O Binding Site BS02

Receptor Information
>8evi Chain O (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKC
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVL
Ligand information
>8evi Chain I (length=143) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctgatcttcagctggttgctgagagttgcagcattgctgagtcttagca
atggatacttcccgattcccctcacaaaaataggtcagtctgtctggcta
gttctgtacttgcagacacagggcatgtggggttcctattttt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8evi Structural basis of cooperative targeting of the CX3CR1 nucleosome
Resolution2.64 Å
Binding residue
(original residue number in PDB)		I172 L174 W215 K219 N221 K223 M225 K229 Y237
Binding residue
(residue number reindexed from 1)		I2 L4 W45 K49 N51 K53 M55 K59 Y67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042826 histone deacetylase binding
GO:0043565 sequence-specific DNA binding
GO:0051525 NFAT protein binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
GO:0140311 protein sequestering activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001944 vasculature development
GO:0002314 germinal center B cell differentiation
GO:0002316 follicular B cell differentiation
GO:0002320 lymphoid progenitor cell differentiation
GO:0002327 immature B cell differentiation
GO:0002572 pro-T cell differentiation
GO:0002573 myeloid leukocyte differentiation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0030098 lymphocyte differentiation
GO:0030218 erythrocyte differentiation
GO:0030225 macrophage differentiation
GO:0030851 granulocyte differentiation
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0035019 somatic stem cell population maintenance
GO:0043011 myeloid dendritic cell differentiation
GO:0043314 negative regulation of neutrophil degranulation
GO:0045347 negative regulation of MHC class II biosynthetic process
GO:0045579 positive regulation of B cell differentiation
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051090 regulation of DNA-binding transcription factor activity
GO:0060033 anatomical structure regression
GO:0090402 oncogene-induced cell senescence
GO:0098508 endothelial to hematopoietic transition
GO:0120186 negative regulation of protein localization to chromatin
GO:1900745 positive regulation of p38MAPK cascade
GO:1902262 apoptotic process involved in blood vessel morphogenesis
GO:1902895 positive regulation of miRNA transcription
GO:1904151 positive regulation of microglial cell mediated cytotoxicity
GO:1904178 negative regulation of adipose tissue development
GO:1904238 pericyte cell differentiation
GO:1905036 positive regulation of antifungal innate immune response
GO:1905453 regulation of myeloid progenitor cell differentiation
GO:2000529 positive regulation of myeloid dendritic cell chemotaxis
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evi, PDBe:8evi, PDBj:8evi
PDBsum8evi
PubMed38267599
UniProtP17433|SPI1_MOUSE Transcription factor PU.1 (Gene Name=Spi1)

[Back to BioLiP]