Structure of PDB 8euj Chain O Binding Site BS02

Receptor Information
>8euj Chain O (length=81) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8euj Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euj Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		R45 I46 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R24 I25 R57 K58 T59
External links