Structure of PDB 8eu2 Chain O Binding Site BS02

Receptor Information
>8eu2 Chain O (length=98) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8eu2 Chain J (length=110) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcg
tttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccg
ggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eu2 Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		P43 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		P6 R35 R46 F47 Q48 R79 V80 T81 M83
External links