Structure of PDB 8cd1 Chain O Binding Site BS02

Receptor Information
>8cd1 Chain O (length=115) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADGGKVLAS
ASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGR
VKALADAAREGGLEF
Ligand information
>8cd1 Chain B (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcuugacgaucauagagcguuggaaccaccugaucccuucccgaacuca
gaagugaaacgacgcaucgccgaugguaguguggggucuccccaugugag
aguaggucaucgucaagcuc
.<<<<<<<<<<....<<<<<.<.....<<<<<<...............>>
>..>>>.....>>>>.>><<<.......<<<<<<<<...>>>>>>>>...
....>>>.>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cd1 70S-PHIKZ014 PHIKZ phage protein occupied ribosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S2 K4 R16 R20 R26 Y30 R31 S32 S33 Q34 H35 Y37 Q39 G45 G46 K47 V48 S51 L55 D56 K57 N66 H99 G100 R101
Binding residue
(residue number reindexed from 1)		S1 K3 R15 R19 R25 Y29 R30 S31 S32 Q33 H34 Y36 Q38 G44 G45 K46 V47 S50 L54 D55 K56 N65 H98 G99 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cd1, PDBe:8cd1, PDBj:8cd1
PDBsum8cd1
PubMed38443577
UniProtQ9HWF1|RL18_PSEAE Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]