Structure of PDB 7sfr Chain O Binding Site BS02

Receptor Information

>7sfr Chain O (length=116) Species: 1773 (Mycobacterium tuberculosis)

ATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVA
AASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGG
RIAALADAARENGLSF

Ligand information

>7sfr Chain B (length=115)

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

.<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.......
>>...>>>>>>.>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7sfr Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): R9 R10 R21 R32 H36 R37 S38 A39 R40 H41 V47 G52 T54 D71 K72 K73 T103 G106 R107
• Binding residue (residue number reindexed from 1): R3 R4 R15 R26 H30 R31 S32 A33 R34 H35 V41 G46 T48 D65 K66 K67 T97 G100 R101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7sfr, PDBe:7sfr, PDBj:7sfr
• PDBsum: 7sfr
• PubMed: 36827973
• UniProt: P9WHD1|RL18_MYCTU Large ribosomal subunit protein uL18 (Gene Name=rplR)