Structure of PDB 7f0d Chain O Binding Site BS02

Receptor Information

>7f0d Chain O (length=116) Species: 419947 (Mycobacterium tuberculosis H37Ra)

ATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVA
AASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGG
RIAALADAARENGLSF

Ligand information

>7f0d Chain B (length=115)

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

...<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<...<...<<<<<<....>>>>>>.....>.
>>...>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7f0d Cryo-EM structure of Mycobacterium tuberculosis 50S ribosomal subunit bound with clarithromycin reveals dynamic and specific interactions with macrolides.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): A7 R9 R13 H17 R21 H36 R37 S38 R40 Q45 V47 T54 I61 D71 K72 K73 G106 R107
• Binding residue (residue number reindexed from 1): A1 R3 R7 H11 R15 H30 R31 S32 R34 Q39 V41 T48 I55 D65 K66 K67 G100 R101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7f0d, PDBe:7f0d, PDBj:7f0d
• PDBsum: 7f0d
• PubMed: 34935599
• UniProt: A5U0A6|RL18_MYCTA Large ribosomal subunit protein uL18 (Gene Name=rplR)