Structure of PDB 6y5d Chain O Binding Site BS02

Receptor Information
>6y5d Chain O (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQ
AVLLP
Ligand information
>6y5d Chain V (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcacaggatgtatatatctgacacgtgcctggagactagggagtaatcc
ccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtg
ctagagctgtctacgaccaattgagcggcctcggcaccgggattctccag
gat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y5d Structural mechanism of cGAS inhibition by the nucleosome.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R43 T77 R78
Binding residue
(residue number reindexed from 1)		R30 T64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y5d, PDBe:6y5d, PDBj:6y5d
PDBsum6y5d
PubMed32911482
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]