Structure of PDB 6swe Chain O Binding Site BS02

Receptor Information
>6swe Chain O (length=143) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAG
YLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAI
REDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6swe Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		G142 S144 R145
Binding residue
(residue number reindexed from 1)		G140 S142 R143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swe, PDBe:6swe, PDBj:6swe
PDBsum6swe
PubMed32029867
UniProtQ9V1A0|RS13_PYRAB Small ribosomal subunit protein uS13 (Gene Name=rps13)

[Back to BioLiP]