Structure of PDB 6spf Chain O Binding Site BS02

Receptor Information
>6spf Chain O (length=115) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADGGKVLAS
ASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGR
VKALADAAREGGLEF
Ligand information
>6spf Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuugacgaucauagagcguuggaaccaccugaucccuucccgaacucag
aagugaaacgacgcaucgccgaugguaguguggggucuccccaugugaga
guaggucaucgucaagc
<<<<<<<<<<....<<<<<<<.....<<<<<<...............>>>
..>>>....>>>>>.>><<<.......<<<<<<<<...>>>>>>>>....
...>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.
Resolution2.89 Å
Binding residue
(original residue number in PDB)		K4 R20 R26 C28 Y30 R31 S33 Q34 H35 V48 S51 L55 K57 R60 N66 I67 K97 H99 G100 R101
Binding residue
(residue number reindexed from 1)		K3 R19 R25 C27 Y29 R30 S32 Q33 H34 V47 S50 L54 K56 R59 N65 I66 K96 H98 G99 R100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6spf, PDBe:6spf, PDBj:6spf
PDBsum6spf
PubMed31611393
UniProtE2RXU0

[Back to BioLiP]