Structure of PDB 6ppk Chain O Binding Site BS02

Receptor Information
>6ppk Chain O (length=100) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNAARLKRHARVRAKRPRLNVFRSNKHIYAQIIVTLASASTLDKDLNVES
TGDTSAATKVGELVAKRAAEKDVVFDRGGYLYHGRVKALADAAREAGLKF
Ligand information
>6ppk Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		K7 L12 H15 R19 R35 S36 N37 K38 H39 T52 L59 D70 Y100 H103
Binding residue
(residue number reindexed from 1)		K1 L6 H9 R13 R23 S24 N25 K26 H27 T35 L42 D53 Y80 H83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]