Structure of PDB 6ppf Chain O Binding Site BS02

Receptor Information

>6ppf Chain O (length=104) Species: 1423 (Bacillus subtilis)

SKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLAS
ASTLTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREA
GLKF

Ligand information

>6ppf Chain B (length=112)

ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa

<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<..........<<<<<...>>>>>..........
>>..>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): K7 H15 R19 R30 F34 R35 S36 N37 K38 H39 Y41 Q43 I45 G50 T52 T71 H103 R105
• Binding residue (residue number reindexed from 1): K2 H10 R14 R25 F29 R30 S31 N32 K33 H34 Y36 Q38 I40 G45 T47 T55 H87 R89

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
• PDBsum: 6ppf
• PubMed: 31665744
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)