Structure of PDB 6nud Chain O Binding Site BS02

Receptor Information
>6nud Chain O (length=212) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAIASPVIKDPITNIPIIPGSS
LKGKMRTLLAKVYNEKVAEKPSDDSDILSRLFGNSKDKRFKMGRLIFRDA
FLSNADELDSLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFEL
IYEITDENENQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFEKLKAT
TVFGNYDVKTLN
Ligand information
>6nud Chain U (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aagugaacagaauuaaacaguuacgaaa
............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nud Coupling of ssRNA cleavage with DNase activity in type III-A CRISPR-Csm revealed by cryo-EM and biochemistry.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		S86 E132 N134 P135
Binding residue
(residue number reindexed from 1)		S85 E131 N133 P134
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6nud, PDBe:6nud, PDBj:6nud
PDBsum6nud
PubMed30814678
UniProtA0A0A7HIF0|CSM3_STRTR CRISPR system Cms endoribonuclease Csm3 (Gene Name=csm3)

[Back to BioLiP]