Structure of PDB 5wcu Chain O Binding Site BS02

Receptor Information
>5wcu Chain O (length=97) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>5wcu Chain T (length=167) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctacatgcatcggatgtatatatctgacacgtgcctggagactaggga
gtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttta
agcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggat
tctcgatggcggccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wcu Revisit of Reconstituted 30-nm Nucleosome Arrays Reveals an Ensemble of Dynamic Structures.
Resolution5.53 Å
Binding residue
(original residue number in PDB)		Y41 R42 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118
Binding residue
(residue number reindexed from 1)		Y4 R5 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wcu, PDBe:5wcu, PDBj:5wcu
PDBsum5wcu
PubMed29959925
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]