Structure of PDB 5v93 Chain O Binding Site BS02

Receptor Information

>5v93 Chain O (length=116) Species: 1773 (Mycobacterium tuberculosis)

ATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVA
AASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGG
RIAALADAARENGLSF

Ligand information

>5v93 Chain B (length=115)

uuacggcggccacagcggcagggaaacgcccggucccauuccgaacccgg
aagcuaagccugccagcgccgaugauacugccccuccggguggaaaagua
ggacaccgccgaaca

.<.<<<<<<.....<<<<<<<<.....<<<<<...............>>>
..>>....>>>>>>.>>.<<...<....<<<<<....>>>>>......>.
>>...>>>>>>.>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5v93 Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
• Resolution: 4.0 Å
• Binding residue (original residue number in PDB): R9 R10 H17 R32 H36 R37 S38 A39 R40 H41 Q45 V47 T54 I61 D71 K73 T103 R107
• Binding residue (residue number reindexed from 1): R3 R4 H11 R26 H30 R31 S32 A33 R34 H35 Q39 V41 T48 I55 D65 K67 T97 R101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5v93, PDBe:5v93, PDBj:5v93
• PDBsum: 5v93
• PubMed: 28977617
• UniProt: P9WHD1|RL18_MYCTU Large ribosomal subunit protein uL18 (Gene Name=rplR)