Structure of PDB 5mlc Chain O Binding Site BS02

Receptor Information
>5mlc Chain O (length=135) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAG
RRAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPG
RILYEISGVAENIARRAVAIAASKMPIRTQFIISG
Ligand information
>5mlc Chain B (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auucugguguccuaggcguagaggaaccacaccaauccaucccgaacuug
gugguuaaacucuacugcggugacgauacuguaggggagguccugcggaa
aaauagcucgacgccaggau
<<<<<<<<<<<....<<<<<<<<.....<<.<.................>
...>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mlc Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R16 M17 G19 E38
Binding residue
(residue number reindexed from 1)		R16 M17 G19 E38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mlc, PDBe:5mlc, PDBj:5mlc
PDBsum5mlc
PubMed27986857
UniProtP17353|RK16_SPIOL Large ribosomal subunit protein uL16c (Gene Name=rpl16)

[Back to BioLiP]