Structure of PDB 5fz5 Chain O Binding Site BS02

Receptor Information
>5fz5 Chain O (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
>5fz5 Chain T (length=56) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acatcggaggtgaatcgaacgttccatagctattatatacacagcgtgct
actgtt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fz5 Transcription Initiation Complex Structures Elucidate DNA Opening
Resolution8.8 Å
Binding residue
(original residue number in PDB)		N69 R98 F99 I103 R105 T112 L114 T124 P191
Binding residue
(residue number reindexed from 1)		N9 R38 F39 I43 R45 T52 L54 T64 P131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001016 RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0001092 TFIIA-class transcription factor complex binding
GO:0001179 RNA polymerase I general transcription initiation factor binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0097718 disordered domain specific binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fz5, PDBe:5fz5, PDBj:5fz5
PDBsum5fz5
PubMed27193681
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]