Structure of PDB 5cky Chain O Binding Site BS02

Receptor Information
>5cky Chain O (length=324) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIA
SIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILEASPESFFRSNN
NLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAG
LSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLV
LICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIF
LAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCN
LSTLNITLLSWSKKRYEAKLKKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cky Base Flipping by MTERF1 Can Accommodate Multiple Conformations and Occurs in a Stepwise Fashion.
Resolution2.62 Å
Binding residue
(original residue number in PDB)		G95 H98 R99 R130 R134 R169 S170 R202 S207 L210 S248 R251 S285 Y288 L323 A324 K327 D353 S354 S355 T358 S384 K385 R387
Binding residue
(residue number reindexed from 1)		G23 H26 R27 R58 R62 R97 S98 R130 S135 L138 S176 R179 S213 Y216 L251 A252 K255 D281 S282 S283 T286 S312 K313 R315
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003690 double-stranded DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5cky, PDBe:5cky, PDBj:5cky
PDBsum5cky
PubMed26523681
UniProtQ99551|MTEF1_HUMAN Transcription termination factor 1, mitochondrial (Gene Name=MTERF1)

[Back to BioLiP]