Structure of PDB 5a2q Chain O Binding Site BS02

Receptor Information
>5a2q Chain O (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADR
DESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSAL
RALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
Ligand information
>5a2q Chain 3 (length=257) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuccccugugaggaacuacugucuucacgcagaaagcgucuagccauggc
guuaguaugagugucgugcagccuccaggacccccccucccgggagagcc
auaguggucugcggaaccggugaguacaccggaauugcgagauuugggcg
ugcccccgcaagacugcuagccgaguaguguugggucgcgaaaggccuug
ugguacugccugauagggugcuugcgagugccccgggaggucucguagac
caccaug
....<<<<.<<<<.....<<<<<..<<<.<<....<<<<<.......>>>
>>.....>>.>>>..>.>>>>>>>>>>>>......<<<<<<<<<<<.<<<
<<<<<<<<<<<<<<..<<<<<<....>>>>>><<<<....>>>>.<<<<.
.>>>>>>>>.>>>>>>>>><<<.....<<........>>....>>>....
>>>>.>><<<<....>>>><<..(((((.>>>>>>>>>>>.)))))....
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a2q Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
Resolution3.9 Å
Binding residue
(original residue number in PDB)
A64 Y72 L151
Binding residue
(residue number reindexed from 1)
A48 Y56 L135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0030218 erythrocyte differentiation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5a2q, PDBe:5a2q, PDBj:5a2q
PDBsum5a2q
PubMed26155016
UniProtP62263|RS14_HUMAN Small ribosomal subunit protein uS11 (Gene Name=RPS14)

[Back to BioLiP]