Structure of PDB 2o93 Chain O Binding Site BS02

Receptor Information

>2o93 Chain O (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHP
VVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEK
IVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTR
VRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVY
GGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVE
IPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Ligand information

>2o93 Chain B (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tggaaagtccccagcggaaagtccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2o93 Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
Resolution	3.05 Å
Binding residue (original residue number in PDB)	R421 R430 Q571
Binding residue (residue number reindexed from 1)	R30 R39 Q180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2o93, PDBe:2o93, PDBj:2o93
PDBsum	2o93
PubMed	18462673
UniProt	Q13469\|NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 (Gene Name=NFATC2)

[Back to BioLiP]