Structure of PDB 8rd8 Chain Nc Binding Site BS02

Receptor Information
>8rd8 Chain Nc (length=113) Species: 45610 (Psychrobacter urativorans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKAARLRRAKKTRAHIRFLGVYRLTVNRTPKHIYAQIISPNGGEVIAQAS
TLDGSLRSGATGNADAATSVGQLIAERAKAAGITKVAFDRSGFKYHGRVK
ALAEAARENGLEF
Ligand information
>8rd8 Chain D8 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugacgaccauagcacgauggcaccaccugaucccuucccgaacucaga
agugaaacaucgucgcgccaaugguagugugguuucgaccaugugagagu
aggucaucgucagcu
<<<<<<<<.....<<<<<<<<....<<<<<<...............>>>.
.>>>...>>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rd8 A new family of bacterial ribosome hibernation factors
Resolution2.62 Å
Binding residue
(original residue number in PDB)		K5 R16 R20 R26 N30 R31 T32 P33 K34 H35 Y37 Q39 G45 G46 V48 Q51 R60 N66 A67 H99 G100 R101
Binding residue
(residue number reindexed from 1)		K2 R13 R17 R23 N27 R28 T29 P30 K31 H32 Y34 Q36 G42 G43 V45 Q48 R57 N63 A64 H96 G97 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M4TUJ2

[Back to BioLiP]